PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00958.1.g00140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 644aa    MW: 69958 Da    PI: 9.0284
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00958.1.g00140.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.58.3e-15368418148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT...TTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmg...kgRtlkqcksrwqkyl 48 
                                   +g W++eEde+l++ + ++G g+W+++++  g   + R++k+c++rw +yl
  Zmw_sc00958.1.g00140.1.am.mk 368 KGLWSPEEDEKLYNHIILYGVGCWSSVPKLAGmhwLQRCGKSCRLRWINYL 418
                                   678**********************************************97 PP

2Myb_DNA-binding46.58.4e-15424467146
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                   rg+++++E++ +v +++ lG++ W+ Ia++++ gRt++++k++w++
  Zmw_sc00958.1.g00140.1.am.mk 424 RGSFSQQEEDAIVGLHEILGNR-WSQIASHLP-GRTDNEIKNFWNS 467
                                   899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.707363418IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.6E-21363421IPR009057Homeodomain-like
SuperFamilySSF466895.08E-28366465IPR009057Homeodomain-like
SMARTSM007179.5E-12367420IPR001005SANT/Myb domain
PfamPF002493.5E-13368418IPR001005SANT/Myb domain
CDDcd001672.01E-10371418No hitNo description
PROSITE profilePS5129424.517419473IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.9E-25422473IPR009057Homeodomain-like
SMARTSM007172.2E-14423471IPR001005SANT/Myb domain
PfamPF002493.8E-13424468IPR001005SANT/Myb domain
CDDcd001678.67E-10426466No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 644 aa     Download sequence    Send to blast
MQVTRARQVR VTPFCDGNNG LLLSSLSSPP PPRRRSGNGR RTNSSTARSI INEASYQVDV  60
QVQHVPSAGR TQQLSVRPSV RRLYQQLSCL HRPAYVLFCP SLRSNDNTRR YHGDPTELDG  120
HPWRAAGQQQ EAGDAKRDPD RSPNAYGTDT TPSAAVPLLP PVPTSPADGF ARVAGATAET  180
VFGCCTAQCR HQDRVVHGSA NPGFSLGLFR GPSVWLDASS SSFSGSLLVL GTLPYIYPGR  240
SRLIGDERTV AHPDGLGRPA IGIAVRSAGS VDRSNASGRN GTATGGHRRR RRPAEAAEGA  300
LVSRGRREAL QSHHPLRRRL LELRAXXXXP SGSQFVRPAV SIDRTRAAGM GRQPGGTGGA  360
GVQQKLRKGL WSPEEDEKLY NHIILYGVGC WSSVPKLAGM HWLQRCGKSC RLRWINYLRP  420
DLKRGSFSQQ EEDAIVGLHE ILGNRWSQIA SHLPGRTDNE IKNFWNSCLK KKLRQRGLDP  480
STHKPISGNA EDQKQQAAST EGGTAPKQQQ QLEVFDPFPL TDSFDGGFDA AGAALYGHLG  540
SCKVDAAGGF VDYSSVLDVP ENLGYGGESS SNSSNTNNWN CAPEVNTVID DVAAQHWGGG  600
DDGEALLEHK FLLPCHGQQE QSMPHFDFDI SRGAVVGEFN LEFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-273664735108B-MYB
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1468474LKKKLRQ
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23273391